PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011095910.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family NF-YB
Protein Properties Length: 330aa    MW: 36851.4 Da    PI: 7.1686
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011095910.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB171.87.4e-54160254195
           NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                     vreqdrf+Pianv+rim+k+lP +akis+daket+qecvse+isf+tsea+d+cqre+rkti+++d+lwa+++lGf+dy+epl+vyl++yre++g
  XP_011095910.1 160 VREQDRFMPIANVIRIMRKILPPHAKISDDAKETIQECVSEYISFITSEANDRCQREQRKTITAEDVLWAMSKLGFDDYIEPLTVYLHRYREFDG 254
                     69******************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.3E-50155257IPR009072Histone-fold
SuperFamilySSF471132.17E-38163262IPR009072Histone-fold
PfamPF008081.1E-25166230IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.5E-17194212No hitNo description
PROSITE patternPS006850197213IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006155.5E-17213231No hitNo description
PRINTSPR006155.5E-17232250No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MCVCVCIYMC MDGWMSKHKC RLPVNAPAVL PNCEALFPTG ECLSLVHNAF SPRGSLLFLF  60
SVFYFFGSIN LDTCHLIPLQ LSVSFKQGKK TTLTLCVVRE RDMELGGNNG GFHGYRRLPR  120
TTSDMKAPDI SMGLPPPQTN HHPAATNAAN AITEDTECVV REQDRFMPIA NVIRIMRKIL  180
PPHAKISDDA KETIQECVSE YISFITSEAN DRCQREQRKT ITAEDVLWAM SKLGFDDYIE  240
PLTVYLHRYR EFDGGDRGSL RGEPLVKRVV DHGSLGYHGF PPAAFHHMAH HHGFYGAAAP  300
MTFFKDAANA GPSQAPVACI EPFPQCKEQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A5e-39161251393NF-YB
4awl_B5e-39161251494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A5e-39161251494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095910.10.0PREDICTED: nuclear transcription factor Y subunit B-6
SwissprotQ84W661e-68NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLD7SZ491e-100D7SZ49_VITVI; Putative uncharacterized protein
STRINGVIT_00s0956g00020.t011e-100(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.12e-65nuclear factor Y, subunit B6